ST8SIA4 Antikörper (Middle Region)
-
- Target Alle ST8SIA4 Antikörper anzeigen
- ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ST8SIA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ST8 SIA4 antibody was raised against the middle region of ST8 IA4
- Aufreinigung
- Affinity purified
- Immunogen
- ST8 SIA4 antibody was raised using the middle region of ST8 IA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM
- Top Product
- Discover our top product ST8SIA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))
- Andere Bezeichnung
- ST8SIA4 (ST8SIA4 Produkte)
- Synonyme
- PST antikoerper, PST-1 antikoerper, SIAT8-D antikoerper, ST8SiaIV antikoerper, Siat8d antikoerper, PST1 antikoerper, SIAT8D antikoerper, ST8SIA-IV antikoerper, ST8Sia-IV antikoerper, pst antikoerper, siat 8D antikoerper, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 antikoerper, St8sia4 antikoerper, ST8SIA4 antikoerper, st8sia4 antikoerper
- Hintergrund
- ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.
- Molekulargewicht
- 41 kDa (MW of target protein)
-