DPYSL3 Antikörper (Middle Region)

Produktnummer ABIN633808

Produktdetails anti-DPYSL3 Antikörper

Target: DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPYSL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DPYSL3 antibody was raised against the middle region of DPYSL3

Aufreinigung: Affinity purified

Immunogen: DPYSL3 antibody was raised using the middle region of DPYSL3 corresponding to a region with amino acids VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DPYSL3 Blocking Peptide, catalog no. 33R-9522, is also available for use as a blocking control in assays to test for specificity of this DPYSL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPYSL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPYSL3

Target: DPYSL3 (Dihydropyrimidinase-Like 3 (DPYSL3))

Andere Bezeichnung: DPYSL3 (DPYSL3 Produkte)

Synonyme: CRMP4A antikoerper, CRMP4B antikoerper, dpysl3 antikoerper, DRP-3 antikoerper, MGC69487 antikoerper, dpysl3-b antikoerper, crmp4 antikoerper, CRMP-4 antikoerper, xCRMP4 antikoerper, DRP-3-B antikoerper, DPYSL3 antikoerper, CRMP4 antikoerper, DRP3 antikoerper, LCRMP antikoerper, ULIP antikoerper, ULIP-1 antikoerper, TUC4 antikoerper, Ulip antikoerper, Ulip1 antikoerper, Crmp4 antikoerper, TUC-4b antikoerper, drp-3 antikoerper, drp3 antikoerper, lcrmp antikoerper, nsp1 antikoerper, tuc-4 antikoerper, tuc4 antikoerper, ulip antikoerper, ulip-1 antikoerper, dihydropyrimidinase like 3 antikoerper, dihydropyrimidinase like 3 L homeolog antikoerper, dihydropyrimidinase-like 3 antikoerper, dihydropyrimidinase like 3 S homeolog antikoerper, DPYSL3 antikoerper, dpysl3 antikoerper, dpysl3.L antikoerper, Dpysl3 antikoerper, dpysl3.S antikoerper

Hintergrund: DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.

Molekulargewicht: 62 kDa (MW of target protein)