GABRA5 Antikörper

Produktnummer ABIN633791

Produktdetails anti-GABRA5 Antikörper

Target: GABRA5 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRA5 Blocking Peptide, catalog no. 33R-1296, is also available for use as a blocking control in assays to test for specificity of this GABRA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRA5

Target: GABRA5 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5))

Andere Bezeichnung: GABRA5 (GABRA5 Produkte)

Synonyme: GABRA5 antikoerper, si:dkey-93p24.1 antikoerper, A230018I05Rik antikoerper, gamma-aminobutyric acid type A receptor alpha5 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, alpha 5 antikoerper, gamma-aminobutyric acid type A receptor alpha 5 subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 antikoerper, gamma-aminobutyric acid receptor subunit alpha-5 antikoerper, GABRA5 antikoerper, gabra5 antikoerper, Gabra5 antikoerper, LOC100653497 antikoerper

Hintergrund: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane