PKDREJ Antikörper (Middle Region)

Produktnummer ABIN633777

Produktdetails anti-PKDREJ Antikörper

Target: PKDREJ (Polycystic Kidney Disease and Receptor for Egg Jelly-Related Protein (PKDREJ))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PKDREJ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PKDREJ antibody was raised against the middle region of PKDREJ

Aufreinigung: Affinity purified

Immunogen: PKDREJ antibody was raised using the middle region of PKDREJ corresponding to a region with amino acids GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PKDREJ Blocking Peptide, catalog no. 33R-3627, is also available for use as a blocking control in assays to test for specificity of this PKDREJ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKDREJ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PKDREJ

Target: PKDREJ (Polycystic Kidney Disease and Receptor for Egg Jelly-Related Protein (PKDREJ))

Andere Bezeichnung: PKDREJ (PKDREJ Produkte)

Synonyme: polycystin family receptor for egg jelly antikoerper, polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin) antikoerper, polycystin (PKD) family receptor for egg jelly antikoerper, Pkdrej antikoerper, PKDREJ antikoerper

Hintergrund: PkDaREJ is a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction.

Molekulargewicht: 254 kDa (MW of target protein)