GRIN2B Antikörper (Middle Region)

Produktnummer ABIN633768

Produktdetails anti-GRIN2B Antikörper

Target: GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRIN2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRIN2 B antibody was raised against the middle region of GRIN2

Aufreinigung: Affinity purified

Immunogen: GRIN2 B antibody was raised using the middle region of GRIN2 corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRIN2B Blocking Peptide, catalog no. 33R-8201, is also available for use as a blocking control in assays to test for specificity of this GRIN2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRIN2B

Target: GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))

Andere Bezeichnung: GRIN2B (GRIN2B Produkte)

Synonyme: NMDAR2B antikoerper, GluN2B antikoerper, MRD6 antikoerper, NR2B antikoerper, hNR3 antikoerper, nmdar2b antikoerper, nr2b antikoerper, AW490526 antikoerper, Nmdar2b antikoerper, glutamate ionotropic receptor NMDA type subunit 2B antikoerper, glutamate receptor, ionotropic, N-methyl D-aspartate 2B L homeolog antikoerper, glutamate receptor, ionotropic, NMDA2B (epsilon 2) antikoerper, GRIN2B antikoerper, Grin2b antikoerper, grin2b.L antikoerper

Hintergrund: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning.

Molekulargewicht: 163 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Synaptic Membrane, Feeding Behaviour, Regulation of long-term Neuronal Synaptic Plasticity