KCNG4 Antikörper (N-Term)

Produktnummer ABIN633751

Produktdetails anti-KCNG4 Antikörper

Target: KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNG4 antibody was raised against the N terminal of KCNG4

Aufreinigung: Affinity purified

Immunogen: KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNG4 Blocking Peptide, catalog no. 33R-7518, is also available for use as a blocking control in assays to test for specificity of this KCNG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNG4

Target: KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))

Andere Bezeichnung: KCNG4 (Kcng4 Produkte)

Synonyme: si:dkey-246g23.3 antikoerper, KV6.3 antikoerper, KV6.4 antikoerper, 4921535I01Rik antikoerper, AW049024 antikoerper, potassium voltage-gated channel, subfamily G, member 4a antikoerper, potassium voltage-gated channel modifier subfamily G member 4 antikoerper, potassium voltage-gated channel, subfamily G, member 4 antikoerper, kcng4a antikoerper, KCNG4 antikoerper, Kcng4 antikoerper

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG4 is a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The protein has strong expression in brain.

Molekulargewicht: 59 kDa (MW of target protein)