HTR3E Antikörper

Produktnummer ABIN633746

Produktdetails anti-HTR3E Antikörper

Target: HTR3E (Serotonin Receptor 3E (HTR3E))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HTR3E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Serotonin receptor 3 E antibody was raised using a synthetic peptide corresponding to a region with amino acids RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Serotonin receptor 3E Blocking Peptide , catalog no. 33R-8266, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HTR3E

Target: HTR3E (Serotonin Receptor 3E (HTR3E))

Andere Bezeichnung: Serotonin Receptor 3E (HTR3E Produkte)

Synonyme: 5-HT3-E antikoerper, 5-HT3E antikoerper, 5-HT3c1 antikoerper, 5-hydroxytryptamine receptor 3E antikoerper, HTR3E antikoerper

Hintergrund: HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.

Molekulargewicht: 53 kDa (MW of target protein)