P2RX4 Antikörper (N-Term)

Produktnummer ABIN633745

Produktdetails anti-P2RX4 Antikörper

Target: P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P2RX4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: P2 RX4 antibody was raised against the N terminal of P2 X4

Aufreinigung: Affinity purified

Immunogen: P2 RX4 antibody was raised using the N terminal of P2 X4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

P2RX4 Blocking Peptide, catalog no. 33R-9751, is also available for use as a blocking control in assays to test for specificity of this P2RX4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P2RX4

Target: P2RX4 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4 (P2RX4))

Andere Bezeichnung: P2RX4 (P2RX4 Produkte)

Synonyme: P2X4 antikoerper, P2X4R antikoerper, AI504491 antikoerper, AW555605 antikoerper, D5Ertd444e antikoerper, p2rx4 antikoerper, p2x4 antikoerper, wu:fi03f02 antikoerper, p2x4r antikoerper, p2rx4.2 antikoerper, p2xr4.2 antikoerper, purinergic receptor P2X 4 antikoerper, purinergic receptor P2X, ligand-gated ion channel 4 antikoerper, purinergic receptor P2X, ligand-gated ion channel, 4a antikoerper, purinergic receptor P2X, ligand gated ion channel, 4 L homeolog antikoerper, purinergic receptor P2X, ligand-gated ion channel, 4b antikoerper, P2RX4 antikoerper, P2rx4 antikoerper, p2rx4a antikoerper, p2rx4.L antikoerper, p2rx4b antikoerper

Hintergrund: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Synaptic Membrane