KCNH3 Antikörper
-
- Target Alle KCNH3 (Kcnh3) Antikörper anzeigen
- KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNH3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- KCNH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLL
- Top Product
- Discover our top product Kcnh3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNH3 Blocking Peptide, catalog no. 33R-8449, is also available for use as a blocking control in assays to test for specificity of this KCNH3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNH3 (Kcnh3) (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3))
- Andere Bezeichnung
- KCNH3 (Kcnh3 Produkte)
- Synonyme
- BEC1 antikoerper, ELK2 antikoerper, Kv12.2 antikoerper, AU019351 antikoerper, C030044P22Rik antikoerper, Elk2 antikoerper, Melk2 antikoerper, Bec1 antikoerper, potassium voltage-gated channel subfamily H member 3 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 3 antikoerper, KCNH3 antikoerper, Kcnh3 antikoerper
- Hintergrund
- The function of KCNH3 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 117 kDa (MW of target protein)
-