FXYD7 Antikörper (N-Term)

Produktnummer ABIN633734

Produktdetails anti-FXYD7 Antikörper

Target: FXYD7 (FXYD Domain Containing Ion Transport Regulator 7 (FXYD7))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FXYD7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FXYD7 antibody was raised against the N terminal of FXYD7

Aufreinigung: Affinity purified

Immunogen: FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FXYD7 Blocking Peptide, catalog no. 33R-5788, is also available for use as a blocking control in assays to test for specificity of this FXYD7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FXYD7

Target: FXYD7 (FXYD Domain Containing Ion Transport Regulator 7 (FXYD7))

Andere Bezeichnung: FXYD7 (FXYD7 Produkte)

Synonyme: 1110035I01Rik antikoerper, FXYD domain containing ion transport regulator 7 antikoerper, FXYD domain-containing ion transport regulator 7 antikoerper, FXYD7 antikoerper, Fxyd7 antikoerper

Hintergrund: This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator.

Molekulargewicht: 8 kDa (MW of target protein)