TRPM4 Antikörper (N-Term)

Produktnummer ABIN633730

Produktdetails anti-TRPM4 Antikörper

Target: TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPM4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRPM4 antibody was raised against the N terminal of TRPM4

Aufreinigung: Affinity purified

Immunogen: TRPM4 antibody was raised using the N terminal of TRPM4 corresponding to a region with amino acids ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPM4 Blocking Peptide, catalog no. 33R-2560, is also available for use as a blocking control in assays to test for specificity of this TRPM4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPM4

Target: TRPM4 (Transient Receptor Potential Cation Channel, Subfamily M, Member 4 (TRPM4))

Andere Bezeichnung: TRPM4 (TRPM4 Produkte)

Synonyme: PFHB1B antikoerper, TRPM4B antikoerper, LTrpC-4 antikoerper, Mls2s antikoerper, 1110030C19Rik antikoerper, AW047689 antikoerper, LTRPC4 antikoerper, TRPM4 antikoerper, transient receptor potential cation channel subfamily M member 4 antikoerper, transient receptor potential cation channel, subfamily M, member 4 antikoerper, TRPM4 antikoerper, Trpm4 antikoerper

Hintergrund: TRPM4 is a calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca2+, it is impermeable to it. TRPM4 mediates transport of monovalent cations (Na+ > K+ > Cs+ > Li+), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca2+ oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production.

Molekulargewicht: 134 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Production of Molecular Mediator of Immune Response