KCNJ9 Antikörper (Middle Region)

Produktnummer ABIN633729

Produktdetails anti-KCNJ9 Antikörper

Target: KCNJ9 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 9 (KCNJ9))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNJ9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNJ9 antibody was raised against the middle region of KCNJ9

Aufreinigung: Affinity purified

Immunogen: KCNJ9 antibody was raised using the middle region of KCNJ9 corresponding to a region with amino acids CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNJ9 Blocking Peptide, catalog no. 33R-1778, is also available for use as a blocking control in assays to test for specificity of this KCNJ9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNJ9

Target: KCNJ9 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 9 (KCNJ9))

Andere Bezeichnung: KCNJ9 (KCNJ9 Produkte)

Synonyme: GIRK3 antikoerper, KIR3.3 antikoerper, 1700085N21Rik antikoerper, Girk3 antikoerper, Kir3.3 antikoerper, mbGIRK3 antikoerper, potassium voltage-gated channel subfamily J member 9 antikoerper, potassium inwardly-rectifying channel, subfamily J, member 9 antikoerper, KCNJ9 antikoerper, Kcnj9 antikoerper

Hintergrund: Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel.

Molekulargewicht: 44 kDa (MW of target protein)