P2RX6 Antikörper (N-Term)
-
- Target Alle P2RX6 Antikörper anzeigen
- P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser P2RX6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- P2 RXL1 antibody was raised against the N terminal of P2 XL1
- Aufreinigung
- Affinity purified
- Immunogen
- P2 RXL1 antibody was raised using the N terminal of P2 XL1 corresponding to a region with amino acids ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN
- Top Product
- Discover our top product P2RX6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
P2RXL1 Blocking Peptide, catalog no. 33R-2688, is also available for use as a blocking control in assays to test for specificity of this P2RXL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 XL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX6 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6))
- Andere Bezeichnung
- P2RXL1 (P2RX6 Produkte)
- Synonyme
- P2RXL1 antikoerper, P2X6 antikoerper, P2XM antikoerper, P2rxl1 antikoerper, P2x6 antikoerper, P2xm antikoerper, Rnap2x6 antikoerper, purinergic receptor P2X 6 antikoerper, purinergic receptor P2X, ligand-gated ion channel, 6 antikoerper, P2X purinoceptor 6 antikoerper, P2RX6 antikoerper, P2rx6 antikoerper, LOC100051842 antikoerper, LOC100588488 antikoerper
- Hintergrund
- P2RXL1 encodes a protein in the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. P2RXL1 is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells.
- Molekulargewicht
- 47 kDa (MW of target protein)
-