MLC1 Antikörper (Middle Region)

Produktnummer ABIN633710

Produktdetails anti-MLC1 Antikörper

Target: MLC1

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MLC1 antibody was raised against the middle region of MLC1

Aufreinigung: Affinity purified

Immunogen: MLC1 antibody was raised using the middle region of MLC1 corresponding to a region with amino acids SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MLC1 Blocking Peptide, catalog no. 33R-8370, is also available for use as a blocking control in assays to test for specificity of this MLC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MLC1

Target: MLC1

Abstract: MLC1 Produkte

Synonyme: LVM antikoerper, MLC antikoerper, VL antikoerper, AW048630 antikoerper, BB074274 antikoerper, Kiaa0027-hp antikoerper, WKL1 antikoerper, mKIAA0027 antikoerper, si:ch211-192n14.1 antikoerper, megalencephalic leukoencephalopathy with subcortical cysts 1 antikoerper, megalencephalic leukoencephalopathy with subcortical cysts 1 homolog (human) antikoerper, MLC1 antikoerper, Mlc1 antikoerper, mlc1 antikoerper

Hintergrund: MLC1 may be a transporter. It may act as a non-selective neuronal cation channel.

Molekulargewicht: 41 kDa (MW of target protein)