KCNV2 Antikörper (N-Term)
-
- Target Alle KCNV2 Antikörper anzeigen
- KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNV2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNV2 antibody was raised against the N terminal of KCNV2
- Aufreinigung
- Affinity purified
- Immunogen
- KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK
- Top Product
- Discover our top product KCNV2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNV2 Blocking Peptide, catalog no. 33R-8183, is also available for use as a blocking control in assays to test for specificity of this KCNV2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))
- Andere Bezeichnung
- KCNV2 (KCNV2 Produkte)
- Synonyme
- KV11.1 antikoerper, Kv8.2 antikoerper, RCD3B antikoerper, potassium voltage-gated channel modifier subfamily V member 2 antikoerper, potassium channel, subfamily V, member 2 antikoerper, KCNV2 antikoerper, Kcnv2 antikoerper
- Hintergrund
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Molekulargewicht
- 62 kDa (MW of target protein)
-