Kv2.1/KCNB1 Antikörper (Middle Region)

Produktnummer ABIN633687

Produktdetails anti-Kv2.1/KCNB1 Antikörper

Target: Kv2.1/KCNB1 (KCNB1) (Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kv2.1/KCNB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNB1 antibody was raised against the middle region of KCNB1

Aufreinigung: Affinity purified

Immunogen: KCNB1 antibody was raised using the middle region of KCNB1 corresponding to a region with amino acids YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNB1 Blocking Peptide, catalog no. 33R-10132, is also available for use as a blocking control in assays to test for specificity of this KCNB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Kv2.1/KCNB1

Target: Kv2.1/KCNB1 (KCNB1) (Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1))

Andere Bezeichnung: KCNB1 (KCNB1 Produkte)

Synonyme: KCNB1 antikoerper, Kcnb1 antikoerper, Kcr1-1 antikoerper, Kv2.1 antikoerper, Shab antikoerper, DRK1PC antikoerper, DRK1 antikoerper, KV2.1 antikoerper, h-DRK1 antikoerper, potassium voltage-gated channel subfamily B member 1 antikoerper, potassium voltage-gated channel, Shab-related subfamily, member 1 antikoerper, potassium channel, voltage gated Shab related subfamily B, member 1 antikoerper, potassium voltage gated channel, Shab-related subfamily, member 1 antikoerper, KCNB1 antikoerper, kcnb1 antikoerper, LOC100541632 antikoerper, Kcnb1 antikoerper

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).

Molekulargewicht: 96 kDa (MW of target protein)

Pathways: Synaptic Membrane