KCNH7 Antikörper
-
- Target Alle KCNH7 Antikörper anzeigen
- KCNH7 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 7 (KCNH7))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNH7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- KCNH7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV
- Top Product
- Discover our top product KCNH7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNH7 Blocking Peptide, catalog no. 33R-7158, is also available for use as a blocking control in assays to test for specificity of this KCNH7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNH7 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 7 (KCNH7))
- Andere Bezeichnung
- KCNH7 (KCNH7 Produkte)
- Synonyme
- KCNH7 antikoerper, kcnh7 antikoerper, ERG3 antikoerper, HERG3 antikoerper, Kv11.3 antikoerper, 9330137I11Rik antikoerper, erg3 antikoerper, potassium voltage-gated channel subfamily H member 7 antikoerper, potassium channel, voltage gated eag related subfamily H, member 7 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 7 antikoerper, KCNH7 antikoerper, kcnh7 antikoerper, LOC100545485 antikoerper, Kcnh7 antikoerper
- Hintergrund
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH7 is a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
- Molekulargewicht
- 83 kDa (MW of target protein)
-