NUDT9 Antikörper
-
- Target Alle NUDT9 Antikörper anzeigen
- NUDT9 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUDT9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA
- Top Product
- Discover our top product NUDT9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUDT9 Blocking Peptide, catalog no. 33R-4873, is also available for use as a blocking control in assays to test for specificity of this NUDT9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDT9 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 9 (NUDT9))
- Andere Bezeichnung
- NUDT9 (NUDT9 Produkte)
- Synonyme
- sb:cb392 antikoerper, wu:fj16b09 antikoerper, wu:fu33g07 antikoerper, zgc:63924 antikoerper, LOC100230616 antikoerper, NUDT10 antikoerper, 1190002C07Rik antikoerper, AI462474 antikoerper, nudix (nucleoside diphosphate linked moiety X)-type motif 9 antikoerper, nudix hydrolase 9 antikoerper, nudt9 antikoerper, NUDT9 antikoerper, Nudt9 antikoerper
- Hintergrund
- Human ADP-ribose pyrophosphatase NUDT9 belongs to a superfamily of Nudix hydrolases that catabolize potentially toxic compounds in the cell. NUDT9 alpha protein is targeted highly specifically to mitochondria, whereas the predicted protein of the NUDT9 beta transcript, which is missing this sequence, exhibits no clear subcellular localization. Investigation of the physical and enzymatic properties of NUDT9 indicates that it is functional as a monomer, optimally active at near neutral pH, and that it requires divalent metal ions and an intact Nudix motif for enzymatic activity.
- Molekulargewicht
- 33 kDa (MW of target protein)
-