Serotonin Receptor 3B Antikörper
-
- Target Alle Serotonin Receptor 3B (HTR3B) Antikörper anzeigen
- Serotonin Receptor 3B (HTR3B)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Serotonin Receptor 3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- Serotonin receptor 3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
- Top Product
- Discover our top product HTR3B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Serotonin receptor 3B Blocking Peptide , catalog no. 33R-7215, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Serotonin Receptor 3B (HTR3B)
- Andere Bezeichnung
- Serotonin Receptor 3B (HTR3B Produkte)
- Synonyme
- HTR3B antikoerper, 5-HT3B antikoerper, 5-hydroxytryptamine receptor 3B antikoerper, 5-hydroxytryptamine (serotonin) receptor 3B antikoerper, HTR3B antikoerper, Htr3b antikoerper
- Hintergrund
- The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-