CACNB1 Antikörper (Middle Region)

Produktnummer ABIN633645

Produktdetails anti-CACNB1 Antikörper

Target: CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNB1 antibody was raised against the middle region of CACNB1

Aufreinigung: Affinity purified

Immunogen: CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNB1 Blocking Peptide, catalog no. 33R-4715, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNB1

Target: CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))

Andere Bezeichnung: CACNB1 (CACNB1 Produkte)

Synonyme: CACNB1 antikoerper, zgc:91982 antikoerper, CAB1 antikoerper, CACNLB1 antikoerper, CCHLB1 antikoerper, Cchb1 antikoerper, Cchlb1 antikoerper, calcium voltage-gated channel auxiliary subunit beta 1 antikoerper, calcium channel, voltage-dependent, beta 1 subunit antikoerper, calcium channel, voltage-dependent, beta 1 subunit S homeolog antikoerper, CACNB1 antikoerper, cacnb1 antikoerper, Cacnb1 antikoerper, cacnb1.S antikoerper

Hintergrund: CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

Molekulargewicht: 58 kDa (MW of target protein)