CACNB1 Antikörper (N-Term)
-
- Target Alle CACNB1 Antikörper anzeigen
- CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CACNB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CACNB1 antibody was raised against the N terminal of CACNB1
- Aufreinigung
- Affinity purified
- Immunogen
- CACNB1 antibody was raised using the N terminal of CACNB1 corresponding to a region with amino acids EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
- Top Product
- Discover our top product CACNB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CACNB1 Blocking Peptide, catalog no. 33R-2782, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNB1 (Calcium Channel, Voltage-Dependent, beta 1 Subunit (CACNB1))
- Andere Bezeichnung
- CACNB1 (CACNB1 Produkte)
- Synonyme
- CACNB1 antikoerper, zgc:91982 antikoerper, CAB1 antikoerper, CACNLB1 antikoerper, CCHLB1 antikoerper, Cchb1 antikoerper, Cchlb1 antikoerper, calcium voltage-gated channel auxiliary subunit beta 1 antikoerper, calcium channel, voltage-dependent, beta 1 subunit antikoerper, calcium channel, voltage-dependent, beta 1 subunit S homeolog antikoerper, CACNB1 antikoerper, cacnb1 antikoerper, Cacnb1 antikoerper, cacnb1.S antikoerper
- Hintergrund
- The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.
- Molekulargewicht
- 66 kDa (MW of target protein)
-