CACNB3 Antikörper (N-Term)

Produktnummer ABIN633634

Produktdetails anti-CACNB3 Antikörper

Target: CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNB3 antibody was raised against the n terminal of CACNB3

Aufreinigung: Affinity purified

Immunogen: CACNB3 antibody was raised using the N terminal of CACNB3 corresponding to a region with amino acids MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNB3 Blocking Peptide, catalog no. 33R-6623, is also available for use as a blocking control in assays to test for specificity of this CACNB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNB3

Target: CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))

Andere Bezeichnung: CACNB3 (CACNB3 Produkte)

Synonyme: vgcc antikoerper, xo28 antikoerper, xo32 antikoerper, o32-a antikoerper, cacnlb3 antikoerper, VGCC antikoerper, CACNB3 antikoerper, CAB3 antikoerper, CACNLB3 antikoerper, Beta3 antikoerper, Cchb3 antikoerper, CACH3B antikoerper, cacnb3 antikoerper, Cacnb3 antikoerper, calcium channel, voltage-dependent, beta 3 subunit S homeolog antikoerper, calcium channel, voltage-dependent, beta 3 subunit L homeolog antikoerper, calcium voltage-gated channel auxiliary subunit beta 3 antikoerper, calcium channel, voltage-dependent, beta 3b antikoerper, calcium channel, voltage-dependent, beta 3 subunit antikoerper, calcium channel, voltage-dependent, beta 3a antikoerper, cacnb3.S antikoerper, cacnb3.L antikoerper, CACNB3 antikoerper, cacnb3b antikoerper, cacnb3 antikoerper, Cacnb3 antikoerper, cacnb3a antikoerper

Hintergrund: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction