KCTD19 Antikörper (N-Term)

Produktnummer ABIN633630

Produktdetails anti-KCTD19 Antikörper

Target: KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCTD19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCTD19 antibody was raised against the n terminal of KCTD19

Aufreinigung: Affinity purified

Immunogen: KCTD19 antibody was raised using the N terminal of KCTD19 corresponding to a region with amino acids DSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCTD19 Blocking Peptide, catalog no. 33R-2168, is also available for use as a blocking control in assays to test for specificity of this KCTD19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCTD19

Target: KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))

Andere Bezeichnung: KCTD19 (KCTD19 Produkte)

Synonyme: 4922504H04Rik antikoerper, potassium channel tetramerisation domain containing 19 antikoerper, potassium channel tetramerization domain containing 19 antikoerper, Kctd19 antikoerper, KCTD19 antikoerper

Hintergrund: The function of KCTD19 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 102 kDa (MW of target protein)