VDAC3 Antikörper (N-Term)

Produktnummer ABIN633623

Produktdetails anti-VDAC3 Antikörper

Target: VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VDAC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VDAC3 antibody was raised against the N terminal of VDAC3

Aufreinigung: Affinity purified

Immunogen: VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VDAC3 Blocking Peptide, catalog no. 33R-8339, is also available for use as a blocking control in assays to test for specificity of this VDAC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VDAC3

Target: VDAC3 (Voltage-Dependent Anion Channel 3 (VDAC3))

Andere Bezeichnung: VDAC3 (VDAC3 Produkte)

Synonyme: HD-VDAC3 antikoerper, VDAC-3 antikoerper, VDAC1P5 antikoerper, VDAC5P antikoerper, VDAC3 antikoerper, wu:fb01e12 antikoerper, zgc:77898 antikoerper, hd-vdac3 antikoerper, ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 3 antikoerper, ATVDAC3 antikoerper, AtVDAC3 antikoerper, Athsr2 antikoerper, F2G14.210 antikoerper, F2G14_210 antikoerper, voltage dependent anion channel 3 antikoerper, voltage dependent anion channel 3 antikoerper, voltage-dependent anion channel 3 antikoerper, voltage-dependent anion channel 3 L homeolog antikoerper, VDAC3 antikoerper, Vdac3 antikoerper, vdac3 antikoerper, vdac3.L antikoerper

Hintergrund: VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase and glycerol kinase.

Molekulargewicht: 31 kDa (MW of target protein)