TRPM3 Antikörper (N-Term)
-
- Target Alle TRPM3 Antikörper anzeigen
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRPM3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRPM3 antibody was raised against the N terminal of TRPM3
- Aufreinigung
- Affinity purified
- Immunogen
- TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL
- Top Product
- Discover our top product TRPM3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRPM3 Blocking Peptide, catalog no. 33R-8112, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
- Andere Bezeichnung
- TRPM3 (TRPM3 Produkte)
- Synonyme
- GON-2 antikoerper, LTRPC3 antikoerper, MLSN2 antikoerper, 6330504P12Rik antikoerper, 9330180E14 antikoerper, AU018608 antikoerper, B930001P07Rik antikoerper, si:dkey-201c13.4 antikoerper, trpm6 antikoerper, transient receptor potential cation channel subfamily M member 3 antikoerper, transient receptor potential cation channel, subfamily M, member 3 antikoerper, TRPM3 antikoerper, Trpm3 antikoerper, trpm3 antikoerper
- Hintergrund
- TRPM3 belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 25 kDa (MW of target protein)
-