DDX28 Antikörper

Produktnummer ABIN633598

Produktdetails anti-DDX28 Antikörper

Target: DDX28 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 28 (DDX28))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DDX28 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX28 Blocking Peptide, catalog no. 33R-3063, is also available for use as a blocking control in assays to test for specificity of this DDX28 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX28 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX28

Target: DDX28 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 28 (DDX28))

Andere Bezeichnung: DDX28 (DDX28 Produkte)

Synonyme: MDDX28 antikoerper, 2410004K13Rik antikoerper, AI449652 antikoerper, Mddx28 antikoerper, DEAD-box helicase 28 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 antikoerper, DDX28 antikoerper, Ddx28 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX28 is an RNA-dependent ATPase. DDX28 is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus.

Molekulargewicht: 59 kDa (MW of target protein)