IGF2BP1 Antikörper (Middle Region)
-
- Target Alle IGF2BP1 Antikörper anzeigen
- IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGF2BP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IGF2 BP1 antibody was raised against the middle region of IGF2 P1
- Aufreinigung
- Affinity purified
- Immunogen
- IGF2 BP1 antibody was raised using the middle region of IGF2 P1 corresponding to a region with amino acids YKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAI
- Top Product
- Discover our top product IGF2BP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IGF2BP1 Blocking Peptide, catalog no. 33R-10146, is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))
- Andere Bezeichnung
- IGF2BP1 (IGF2BP1 Produkte)
- Synonyme
- IGF2BP1 antikoerper, ZBP1 antikoerper, CRD-BP antikoerper, CRDBP antikoerper, IMP-1 antikoerper, IMP1 antikoerper, VICKZ1 antikoerper, AL024068 antikoerper, AW549074 antikoerper, Crdbp antikoerper, D030026A21Rik antikoerper, D11Moh40e antikoerper, D11Moh45 antikoerper, Neilsen antikoerper, Zbp1 antikoerper, Imp1 antikoerper, wu:fi72a06 antikoerper, zgc:152963 antikoerper, insulin like growth factor 2 mRNA binding protein 1 antikoerper, insulin-like growth factor 2 mRNA binding protein 1 antikoerper, IGF2BP1 antikoerper, Igf2bp1 antikoerper, igf2bp1 antikoerper
- Hintergrund
- IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.
- Molekulargewicht
- 63 kDa (MW of target protein)
-