ALKBH8 Antikörper
-
- Target Alle ALKBH8 Antikörper anzeigen
- ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALKBH8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG
- Top Product
- Discover our top product ALKBH8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALKBH8 Blocking Peptide, catalog no. 33R-5870, is also available for use as a blocking control in assays to test for specificity of this ALKBH8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALKBH8 (AlkB, Alkylation Repair Homolog 8 (ALKBH8))
- Andere Bezeichnung
- ALKBH8 (ALKBH8 Produkte)
- Synonyme
- ABH8 antikoerper, 4930562C03Rik antikoerper, 8030431D03Rik antikoerper, 9430088N01Rik antikoerper, Abh8 antikoerper, alkB homolog 8, tRNA methyltransferase antikoerper, ALKBH8 antikoerper, Alkbh8 antikoerper
- Hintergrund
- ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA and catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA.
- Molekulargewicht
- 27 kDa (MW of target protein)
-