RNMT Antikörper
-
- Target Alle RNMT Antikörper anzeigen
- RNMT (RNA Guanine-7 Methyltransferase (RNMT))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNMT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RNMT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYF
- Top Product
- Discover our top product RNMT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNMT Blocking Peptide, catalog no. 33R-8147, is also available for use as a blocking control in assays to test for specificity of this RNMT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNMT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNMT (RNA Guanine-7 Methyltransferase (RNMT))
- Andere Bezeichnung
- RNMT (RNMT Produkte)
- Synonyme
- xCMT1 antikoerper, MET antikoerper, RG7MT1 antikoerper, hCMT1c antikoerper, 2610002P10Rik antikoerper, AI848273 antikoerper, Rg7mt1 antikoerper, mKIAA0398 antikoerper, rnmt antikoerper, im:6910566 antikoerper, wu:fi09c12 antikoerper, RNA (guanine-7-) methyltransferase L homeolog antikoerper, RNA guanine-7 methyltransferase antikoerper, RNA (guanine-7-) methyltransferase antikoerper, rnmt.L antikoerper, RNMT antikoerper, Rnmt antikoerper, rnmt antikoerper
- Hintergrund
- RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
- Molekulargewicht
- 55 kDa (MW of target protein)
-