EIF3G Antikörper (Middle Region)

Produktnummer ABIN633566

Produktdetails anti-EIF3G Antikörper

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF3G Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF3 G antibody was raised against the middle region of EIF3

Aufreinigung: Affinity purified

Immunogen: EIF3 G antibody was raised using the middle region of EIF3 corresponding to a region with amino acids LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3G Blocking Peptide, catalog no. 33R-5350, is also available for use as a blocking control in assays to test for specificity of this EIF3G antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF3G

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Andere Bezeichnung: EIF3G (EIF3G Produkte)

Synonyme: EIF3-P42 antikoerper, EIF3S4 antikoerper, eIF3-delta antikoerper, eIF3-p44 antikoerper, 44kDa antikoerper, D0Jmb4 antikoerper, Eif3s4 antikoerper, TU-189B2 antikoerper, p44 antikoerper, eif3s4 antikoerper, zgc:56553 antikoerper, eIF3g-A antikoerper, eif3s4-A antikoerper, eIF3g antikoerper, eIF3-S4 antikoerper, An16g05260 antikoerper, AO090011000648 antikoerper, eukaryotic translation initiation factor 3 subunit G antikoerper, eukaryotic translation initiation factor 3, subunit G antikoerper, eukaryotic translation initiation factor 3 subunit G S homeolog antikoerper, Eukaryotic translation initiation factor 3 subunit G antikoerper, eukaryotic translation initiation factor antikoerper, EIF3G antikoerper, Eif3g antikoerper, eif3g antikoerper, eif3g.S antikoerper, eif-3.G antikoerper, eIF3g antikoerper, ANI_1_732144 antikoerper, AOR_1_1112054 antikoerper, VDBG_00824 antikoerper, MGYG_08099 antikoerper, Tsp_04379 antikoerper

Hintergrund: EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization