C14orf21 Antikörper (Middle Region)

Produktnummer ABIN633556

Produktdetails anti-C14orf21 Antikörper

Target: C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C14orf21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF21 antibody was raised against the middle region of C14 rf21

Aufreinigung: Affinity purified

Immunogen: C14 ORF21 antibody was raised using the middle region of C14 rf21 corresponding to a region with amino acids GGTILESERARPRGSQSSEAQKTPAQECKPADFEVPETFLNRLQDLSSSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF21 Blocking Peptide, catalog no. 33R-3302, is also available for use as a blocking control in assays to test for specificity of this C14ORF21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C14orf21

Target: C14orf21 (Chromosome 14 Open Reading Frame 21 (C14orf21))

Andere Bezeichnung: C14ORF21 (C14orf21 Produkte)

Synonyme: MGC69156 antikoerper, C14orf21 antikoerper, 2610027L16Rik antikoerper, NOP9 nucleolar protein L homeolog antikoerper, NOP9 nucleolar protein antikoerper, similar to S. cerevisiae YJL010C antikoerper, nop9.L antikoerper, nop9 antikoerper, NOP9 antikoerper, Nop9 antikoerper, CaO19.11959 antikoerper

Hintergrund: The specific function of C14orf21 is not yet known.

Molekulargewicht: 69 kDa (MW of target protein)