RPUSD3 Antikörper (Middle Region)

Produktnummer ABIN633554

Produktdetails anti-RPUSD3 Antikörper

Target: RPUSD3 (RNA Pseudouridylate Synthase Domain Containing 3 (RPUSD3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPUSD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPUSD3 antibody was raised against the middle region of RPUSD3

Aufreinigung: Affinity purified

Immunogen: RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPUSD3 Blocking Peptide, catalog no. 33R-6594, is also available for use as a blocking control in assays to test for specificity of this RPUSD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPUSD3

Target: RPUSD3 (RNA Pseudouridylate Synthase Domain Containing 3 (RPUSD3))

Andere Bezeichnung: RPUSD3 (RPUSD3 Produkte)

Synonyme: AI527266 antikoerper, RGD1307582 antikoerper, RNA pseudouridylate synthase domain containing 3 antikoerper, RPUSD3 antikoerper, Rpusd3 antikoerper

Hintergrund: The specific function of RPUSD3 is not yet known.

Molekulargewicht: 37 kDa (MW of target protein)