FAM71D Antikörper (Middle Region)

Produktnummer ABIN633553

Produktdetails anti-FAM71D Antikörper

Target: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM71D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM71 D antibody was raised against the middle region of FAM71

Aufreinigung: Affinity purified

Immunogen: FAM71 D antibody was raised using the middle region of FAM71 corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM71D Blocking Peptide, catalog no. 33R-9860, is also available for use as a blocking control in assays to test for specificity of this FAM71D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM71D

Target: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Andere Bezeichnung: FAM71D (FAM71D Produkte)

Synonyme: GARI-L2 antikoerper, 4921509E07Rik antikoerper, 4930516C23Rik antikoerper, C14orf54 antikoerper, C10H14orf54 antikoerper, family with sequence similarity 71, member D antikoerper, family with sequence similarity 71 member D antikoerper, Fam71d antikoerper, FAM71D antikoerper

Hintergrund: The function of FAM71 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)