LSM4 Antikörper

Produktnummer ABIN633518

Produktdetails anti-LSM4 Antikörper

Target: LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (LSM4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSM4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LSM4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSM4 Blocking Peptide, catalog no. 33R-3529, is also available for use as a blocking control in assays to test for specificity of this LSM4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSM4

Target: LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (LSM4))

Andere Bezeichnung: LSM4 (LSM4 Produkte)

Synonyme: GRP antikoerper, YER112W antikoerper, LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog antikoerper, LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated antikoerper, lsm4.S antikoerper, LSM4 antikoerper, Lsm4 antikoerper

Hintergrund: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molekulargewicht: 15 kDa (MW of target protein)