PRPF8 Antikörper
-
- Target Alle PRPF8 Antikörper anzeigen
- PRPF8 (PRP8 Pre-mRNA Processing Factor 8 (PRPF8))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRPF8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PRPF8 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR
- Top Product
- Discover our top product PRPF8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRPF8 Blocking Peptide, catalog no. 33R-8515, is also available for use as a blocking control in assays to test for specificity of this PRPF8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRPF8 (PRP8 Pre-mRNA Processing Factor 8 (PRPF8))
- Andere Bezeichnung
- PRPF8 (PRPF8 Produkte)
- Synonyme
- id:ibd1257 antikoerper, ik:tdsubc_2a9 antikoerper, im:7141966 antikoerper, tdsubc_2a9 antikoerper, wu:fb37c02 antikoerper, wu:fb73e06 antikoerper, xx:tdsubc_2a9 antikoerper, zgc:56504 antikoerper, hprp8 antikoerper, prp-8 antikoerper, prp8 antikoerper, prpc8 antikoerper, rp13 antikoerper, HPRP8 antikoerper, PRP8 antikoerper, PRPC8 antikoerper, RP13 antikoerper, SNRNP220 antikoerper, AU019467 antikoerper, D11Bwg0410e antikoerper, DBF3/PRP8 antikoerper, Prp8 antikoerper, Sfprp8l antikoerper, pre-mRNA processing factor 8 antikoerper, pre-mRNA processing factor 8 S homeolog antikoerper, Prpf8 antikoerper, prpf8 antikoerper, prpf8.S antikoerper, PRPF8 antikoerper
- Hintergrund
- Pre-mRNA splicing occurs in 2 sequential transesterification steps. PRPF8 is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. The gene encoding PRPF8 is a candidate gene for autosomal dominant retinitis pigmentosa.Pre-mRNA splicing occurs in 2 sequential transesterification steps.
- Molekulargewicht
- 273 kDa (MW of target protein)
-