LARP1 Antikörper (N-Term)
-
- Target Alle LARP1 Antikörper anzeigen
- LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LARP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LARP1 antibody was raised against the N terminal of LARP1
- Aufreinigung
- Affinity purified
- Immunogen
- LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN
- Top Product
- Discover our top product LARP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LARP1 Blocking Peptide, catalog no. 33R-3771, is also available for use as a blocking control in assays to test for specificity of this LARP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))
- Andere Bezeichnung
- LARP1 (LARP1 Produkte)
- Synonyme
- RGD1306683 antikoerper, wu:fb92d03 antikoerper, wu:fd15e07 antikoerper, 3110040D16RIK antikoerper, MGC98945 antikoerper, LARP antikoerper, 1810024J12Rik antikoerper, 3110040D16Rik antikoerper, Larp antikoerper, mKIAA0731 antikoerper, La ribonucleoprotein domain family, member 1 antikoerper, La ribonucleoprotein domain family member 1 antikoerper, La ribonucleoprotein domain family member 1 L homeolog antikoerper, Larp1 antikoerper, larp1 antikoerper, LARP1 antikoerper, larp1.L antikoerper
- Hintergrund
- LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.
- Molekulargewicht
- 116 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion
-