LARP1 Antikörper (N-Term)

Produktnummer ABIN633490

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch LARP1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für LARP1 Antikörper (N-Term) (ABIN633490)

Target: LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LARP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LARP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: LARP1 antibody was raised against the N terminal of LARP1

Aufreinigung: Affinity purified

Immunogen: LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids HKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LARP1 Blocking Peptide, (ABIN939157), is also available for use as a blocking control in assays to test for specificity of this LARP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LARP1

Target: LARP1 (La Ribonucleoprotein Domain Family, Member 1 (LARP1))

Andere Bezeichnung: LARP1

Hintergrund: LARP1 belongs to the LARP family and it contains 1 HTH La-type RNA-binding domain. The exact function of LARP1 remains unknown.

Molekulargewicht: 116 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion