PUF60 Antikörper (C-Term)
-
- Target Alle PUF60 Antikörper anzeigen
- PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PUF60 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PUF60 antibody was raised against the C terminal of PUF60
- Aufreinigung
- Affinity purified
- Immunogen
- PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
- Top Product
- Discover our top product PUF60 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PUF60 Blocking Peptide, catalog no. 33R-2474, is also available for use as a blocking control in assays to test for specificity of this PUF60 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUF60 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))
- Andere Bezeichnung
- PUF60 (PUF60 Produkte)
- Synonyme
- FIR antikoerper, RoBPI antikoerper, SIAHBP1 antikoerper, fc21a05 antikoerper, wu:fc21a05 antikoerper, wu:fi43a08 antikoerper, 2410104I19Rik antikoerper, 2810454F19Rik antikoerper, Siahbp1 antikoerper, fe37c05 antikoerper, repressor antikoerper, si:ch211-12p8.2 antikoerper, si:zc12p8.2 antikoerper, wu:fb33e11 antikoerper, wu:fe37c05 antikoerper, zgc:86806 antikoerper, poly(U) binding splicing factor 60 antikoerper, poly-U binding splicing factor a antikoerper, poly-U binding splicing factor 60 antikoerper, poly-U binding splicing factor b antikoerper, PUF60 antikoerper, puf60a antikoerper, Puf60 antikoerper, puf60b antikoerper
- Hintergrund
- PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.
- Molekulargewicht
- 58 kDa (MW of target protein)
-