ERAL1 Antikörper
-
- Target Alle ERAL1 Antikörper anzeigen
- ERAL1 (Era G-Protein-Like 1 (ERAL1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERAL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS
- Top Product
- Discover our top product ERAL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ERAL1 Blocking Peptide, catalog no. 33R-4708, is also available for use as a blocking control in assays to test for specificity of this ERAL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERAL1 (Era G-Protein-Like 1 (ERAL1))
- Andere Bezeichnung
- ERAL1 (ERAL1 Produkte)
- Synonyme
- ERAL1 antikoerper, 2610524P08Rik antikoerper, 9130407C09Rik antikoerper, AU019798 antikoerper, Era antikoerper, M-ERA antikoerper, MERA-S antikoerper, MERA-W antikoerper, GdERA antikoerper, si:ch211-207c6.1 antikoerper, ERA antikoerper, ERAL1A antikoerper, H-ERA antikoerper, HERA-A antikoerper, HERA-B antikoerper, eral1 antikoerper, Era like 12S mitochondrial rRNA chaperone 1 antikoerper, Era (G-protein)-like 1 (E. coli) antikoerper, Era-like 12S mitochondrial rRNA chaperone 1 antikoerper, Era-like 12S mitochondrial rRNA chaperone 1 L homeolog antikoerper, GTP-binding protein era homolog antikoerper, ERAL1 antikoerper, Eral1 antikoerper, eral1 antikoerper, eral1.L antikoerper, eral antikoerper
- Hintergrund
- ERAL1 belongs to the era/mnmE GTP-binding protein family.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-