EIF2S2 Antikörper (N-Term)
-
- Target Alle EIF2S2 Antikörper anzeigen
- EIF2S2 (Eukaryotic Translation Initiation Factor 2, Subunit 2 Beta, 38kDa (EIF2S2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF2S2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF2 S2 antibody was raised against the N terminal of EIF2 2
- Aufreinigung
- Affinity purified
- Immunogen
- EIF2 S2 antibody was raised using the N terminal of EIF2 2 corresponding to a region with amino acids DEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKD
- Top Product
- Discover our top product EIF2S2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF2S2 Blocking Peptide, catalog no. 33R-1911, is also available for use as a blocking control in assays to test for specificity of this EIF2S2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2S2 (Eukaryotic Translation Initiation Factor 2, Subunit 2 Beta, 38kDa (EIF2S2))
- Andere Bezeichnung
- EIF2S2 (EIF2S2 Produkte)
- Synonyme
- EIF2 antikoerper, EIF2B antikoerper, EIF2beta antikoerper, PPP1R67 antikoerper, eIF-2-beta antikoerper, 2810026E11Rik antikoerper, 38kDa antikoerper, AA408636 antikoerper, AA571381 antikoerper, AA986487 antikoerper, AW822225 antikoerper, D2Ertd303e antikoerper, zgc:77084 antikoerper, wu:fc26g03 antikoerper, wu:fu10f07 antikoerper, MGC130959 antikoerper, DDBDRAFT_0205105 antikoerper, DDBDRAFT_0234112 antikoerper, DDB_0205105 antikoerper, DDB_0234112 antikoerper, AO090005001412 antikoerper, eukaryotic translation initiation factor 2 subunit beta antikoerper, eukaryotic translation initiation factor 2, subunit 2 (beta) antikoerper, eukaryotic translation initiation factor 2, subunit 2 beta antikoerper, eukaryotic translation initiation factor 2 subunit beta L homeolog antikoerper, eIF-3 beta antikoerper, hypothetical protein antikoerper, eukaryotic translation initiation factor 2 subunit 2 antikoerper, EIF2S2 antikoerper, Eif2s2 antikoerper, eif2s2 antikoerper, eif2s2.L antikoerper, eIF2s2 antikoerper, TP02_0678 antikoerper, EDI_093670 antikoerper, AOR_1_2450174 antikoerper, MGYG_05853 antikoerper, PGTG_10708 antikoerper, LOC101111733 antikoerper
- Hintergrund
- Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation.
- Molekulargewicht
- 38 kDa (MW of target protein)
-