CSTF3 Antikörper (N-Term)
-
- Target Alle CSTF3 Antikörper anzeigen
- CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSTF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CSTF3 antibody was raised against the N terminal of CSTF3
- Aufreinigung
- Affinity purified
- Immunogen
- CSTF3 antibody was raised using the N terminal of CSTF3 corresponding to a region with amino acids YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE
- Top Product
- Discover our top product CSTF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CSTF3 Blocking Peptide, catalog no. 33R-10133, is also available for use as a blocking control in assays to test for specificity of this CSTF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))
- Andere Bezeichnung
- CSTF3 (CSTF3 Produkte)
- Synonyme
- cstf3 antikoerper, MGC76035 antikoerper, CSTF3 antikoerper, wu:fa99c02 antikoerper, wu:fb18b09 antikoerper, zgc:56028 antikoerper, 4732468G05Rik antikoerper, C79532 antikoerper, CstF-77 antikoerper, cstf3a antikoerper, CSTF-77 antikoerper, cleavage stimulation factor, 3' pre-RNA, subunit 3 antikoerper, cleavage stimulation factor subunit 3 antikoerper, cstf3 antikoerper, CSTF3 antikoerper, LOC100544392 antikoerper, LOC100641283 antikoerper, Cstf3 antikoerper, cstf3.S antikoerper
- Hintergrund
- CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex.
- Molekulargewicht
- 79 kDa (MW of target protein)
-