PUM2 Antikörper
-
- Target Alle PUM2 Antikörper anzeigen
- PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PUM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PUM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAW
- Top Product
- Discover our top product PUM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PUM2 Blocking Peptide, catalog no. 33R-6245, is also available for use as a blocking control in assays to test for specificity of this PUM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PUM2 (Pumilio Homolog 2 (Drosophila) (PUM2))
- Andere Bezeichnung
- PUM2 (PUM2 Produkte)
- Synonyme
- pum-2 antikoerper, 5730503J23Rik antikoerper, Pumm2 antikoerper, mKIAA0235 antikoerper, PUMH2 antikoerper, PUML2 antikoerper, pumilio RNA binding family member 2 antikoerper, pumilio RNA-binding family member 2 antikoerper, pum2 antikoerper, Pum2 antikoerper, PUM2 antikoerper
- Hintergrund
- PUM2 is a sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of mRNA targets. Its interactions and tissue specificity suggest that it may be required to support proliferation and self-renewal of stem cells by regulating the translation of key transcripts.
- Molekulargewicht
- 114 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-