TTC14 Antikörper (N-Term)
-
- Target Alle TTC14 Antikörper anzeigen
- TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TTC14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TTC14 antibody was raised against the N terminal of TTC14
- Aufreinigung
- Affinity purified
- Immunogen
- TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK
- Top Product
- Discover our top product TTC14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TTC14 Blocking Peptide, catalog no. 33R-5194, is also available for use as a blocking control in assays to test for specificity of this TTC14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))
- Andere Bezeichnung
- TTC14 (TTC14 Produkte)
- Synonyme
- DRDL5813 antikoerper, PRO19630 antikoerper, 2700016E08Rik antikoerper, 4930434D01Rik antikoerper, 4931403I22Rik antikoerper, 4933402I15Rik antikoerper, AI662468 antikoerper, AU014779 antikoerper, AW561908 antikoerper, cI-44 antikoerper, mKIAA1980 antikoerper, zgc:113259 antikoerper, tetratricopeptide repeat domain 14 antikoerper, TTC14 antikoerper, Ttc14 antikoerper, ttc14 antikoerper
- Hintergrund
- TTC14 belongs to the TTC14 family and contains 1 S1 motif domain and 4 TPR repeats. The functions of TTC14 remain unknown.
- Molekulargewicht
- 88 kDa (MW of target protein)
-