CPSF1 Antikörper (Middle Region)

Produktnummer ABIN633437

Produktdetails anti-CPSF1 Antikörper

Target: CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPSF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CPSF1 antibody was raised against the middle region of CPSF1

Aufreinigung: Affinity purified

Immunogen: CPSF1 antibody was raised using the middle region of CPSF1 corresponding to a region with amino acids GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPSF1 Blocking Peptide, catalog no. 33R-3195, is also available for use as a blocking control in assays to test for specificity of this CPSF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPSF1

Target: CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))

Andere Bezeichnung: CPSF1 (CPSF1 Produkte)

Synonyme: CG10110 antikoerper, CPSF antikoerper, CPSF-160 antikoerper, CPSF160 antikoerper, Cpsf antikoerper, Dmel\\CG10110 antikoerper, anon-WO0118547.217 antikoerper, cpsf antikoerper, dCPSF-160 antikoerper, wu:fb24c01 antikoerper, CPSF1 antikoerper, DKFZp469K0832 antikoerper, HSU37012 antikoerper, P/cl.18 antikoerper, ATCPSF160 antikoerper, K17N15.21 antikoerper, K17N15_21 antikoerper, cleavage and polyadenylation specificity factor 160 antikoerper, cleavage and polyadenylation specific factor 1 antikoerper, Cleavage and polyadenylation specificity factor 160 antikoerper, cleavage and polyadenylation specific factor 1 L homeolog antikoerper, cleavage and polyadenylation specificity factor subunit 1 antikoerper, cleavage and polyadenylation specificity factor 160 antikoerper, Cpsf1 antikoerper, Cpsf160 antikoerper, cpsf1.L antikoerper, cpsf1 antikoerper, CPSF1 antikoerper, Tsp_05366 antikoerper, CPSF160 antikoerper

Hintergrund: CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.

Molekulargewicht: 161 kDa (MW of target protein)