ERAL1 Antikörper

Produktnummer ABIN633436

Produktdetails anti-ERAL1 Antikörper

Target: ERAL1 (Era G-Protein-Like 1 (ERAL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERAL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERAL1 Blocking Peptide, catalog no. 33R-4675, is also available for use as a blocking control in assays to test for specificity of this ERAL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERAL1

Target: ERAL1 (Era G-Protein-Like 1 (ERAL1))

Andere Bezeichnung: ERAL1 (ERAL1 Produkte)

Synonyme: ERAL1 antikoerper, 2610524P08Rik antikoerper, 9130407C09Rik antikoerper, AU019798 antikoerper, Era antikoerper, M-ERA antikoerper, MERA-S antikoerper, MERA-W antikoerper, GdERA antikoerper, si:ch211-207c6.1 antikoerper, ERA antikoerper, ERAL1A antikoerper, H-ERA antikoerper, HERA-A antikoerper, HERA-B antikoerper, eral1 antikoerper, Era like 12S mitochondrial rRNA chaperone 1 antikoerper, Era (G-protein)-like 1 (E. coli) antikoerper, Era-like 12S mitochondrial rRNA chaperone 1 antikoerper, Era-like 12S mitochondrial rRNA chaperone 1 L homeolog antikoerper, GTP-binding protein era homolog antikoerper, ERAL1 antikoerper, Eral1 antikoerper, eral1 antikoerper, eral1.L antikoerper, eral antikoerper

Hintergrund: The function of ERAL protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly