POLDIP3 Antikörper

Produktnummer ABIN633420

Produktdetails anti-POLDIP3 Antikörper

Target: POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLDIP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: POLDIP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLDIP3 Blocking Peptide, catalog no. 33R-1855, is also available for use as a blocking control in assays to test for specificity of this POLDIP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLDIP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLDIP3

Target: POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))

Andere Bezeichnung: POLDIP3 (POLDIP3 Produkte)

Synonyme: PDIP46 antikoerper, SKAR antikoerper, 1110008P04Rik antikoerper, AA408269 antikoerper, AL022852 antikoerper, C77954 antikoerper, mKIAA1649 antikoerper, polymerase (DNA-directed), delta interacting protein 3 S homeolog antikoerper, DNA polymerase delta interacting protein 3 antikoerper, polymerase (DNA-directed), delta interacting protein 3 antikoerper, poldip3.S antikoerper, POLDIP3 antikoerper, Poldip3 antikoerper

Hintergrund: POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified.

Molekulargewicht: 46 kDa (MW of target protein)