RPS24 Antikörper (Middle Region)

Produktnummer ABIN633411

Produktdetails anti-RPS24 Antikörper

Target: RPS24 (Ribosomal Protein S24 (RPS24))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS24 antibody was raised against the middle region of RPS24

Aufreinigung: Affinity purified

Immunogen: RPS24 antibody was raised using the middle region of RPS24 corresponding to a region with amino acids GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS24 Blocking Peptide, catalog no. 33R-3257, is also available for use as a blocking control in assays to test for specificity of this RPS24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS24

Target: RPS24 (Ribosomal Protein S24 (RPS24))

Andere Bezeichnung: RPS24 (RPS24 Produkte)

Synonyme: DBA3 antikoerper, S24 antikoerper, ribosomal protein S24 L homeolog antikoerper, ribosomal protein S24 antikoerper, rps24.L antikoerper, RPS24 antikoerper, Rps24 antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 15 kDa (MW of target protein)