RBM4 Antikörper (Middle Region)
-
- Target Alle RBM4 Antikörper anzeigen
- RBM4 (RNA Binding Motif Protein 4 (RBM4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBM4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBM4 antibody was raised against the middle region of RBM4
- Aufreinigung
- Affinity purified
- Immunogen
- RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY
- Top Product
- Discover our top product RBM4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM4 Blocking Peptide, catalog no. 33R-8981, is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM4 (RNA Binding Motif Protein 4 (RBM4))
- Andere Bezeichnung
- RBM4 (RBM4 Produkte)
- Synonyme
- rbm4 antikoerper, rna-bp4 antikoerper, wu:fc31f07 antikoerper, wu:fc57h11 antikoerper, zgc:56302 antikoerper, LARK antikoerper, RBM4A antikoerper, ZCCHC21 antikoerper, ZCRB3A antikoerper, 4921506I22Rik antikoerper, Lark1 antikoerper, Mlark antikoerper, Rbm4a antikoerper, lark antikoerper, Rbm4 antikoerper, RNA binding motif protein 4.1 antikoerper, RNA binding motif protein 4 antikoerper, RNA-binding protein 14 antikoerper, RNA-binding protein lark antikoerper, rbm4.1 antikoerper, RBM4 antikoerper, LOC610648 antikoerper, Rbm4 antikoerper, LARK antikoerper
- Hintergrund
- RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Photoperiodism
-