APOBEC3F Antikörper (Middle Region)
-
- Target Alle APOBEC3F Antikörper anzeigen
- APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APOBEC3F Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ApoBEC3 F antibody was raised against the middle region of APOBEC3
- Aufreinigung
- Affinity purified
- Immunogen
- ApoBEC3 F antibody was raised using the middle region of APOBEC3 corresponding to a region with amino acids MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQ
- Top Product
- Discover our top product APOBEC3F Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ApoBEC3F Blocking Peptide, catalog no. 33R-6629, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3F antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))
- Andere Bezeichnung
- ApoBEC3F (APOBEC3F Produkte)
- Synonyme
- A3F antikoerper, ARP8 antikoerper, BK150C2.4.MRNA antikoerper, KA6 antikoerper, APOBEC3F antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 3F antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F antikoerper, APOBEC3F antikoerper
- Hintergrund
- This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.
- Molekulargewicht
- 45 kDa (MW of target protein)
-