KHSRP Antikörper (Middle Region)

Produktnummer ABIN633384

Produktdetails anti-KHSRP Antikörper

Target: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KHSRP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KHSRP antibody was raised against the middle region of KHSRP

Aufreinigung: Affinity purified

Immunogen: KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KHSRP Blocking Peptide, catalog no. 33R-9939, is also available for use as a blocking control in assays to test for specificity of this KHSRP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHSRP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KHSRP

Target: KHSRP (KH-Type Splicing Regulatory Protein (KHSRP))

Andere Bezeichnung: KHSRP (KHSRP Produkte)

Synonyme: FBP2 antikoerper, FUBP2 antikoerper, KSRP antikoerper, 6330409F21Rik antikoerper, Fbp2 antikoerper, Fubp2 antikoerper, Ksrp antikoerper, Marta1 antikoerper, KHSRP antikoerper, VgRBP71 antikoerper, fbp2 antikoerper, ksrp antikoerper, fubp2 antikoerper, fc94c12 antikoerper, wu:fb25b12 antikoerper, wu:fc10e10 antikoerper, wu:fc94c12 antikoerper, zgc:163038 antikoerper, khsrp-b antikoerper, KH-type splicing regulatory protein antikoerper, KH-type splicing regulatory protein L homeolog antikoerper, KH-type splicing regulatory protein S homeolog antikoerper, KHSRP antikoerper, Khsrp antikoerper, khsrp.L antikoerper, khsrp antikoerper, khsrp.S antikoerper

Hintergrund: KHSRP binds to the dendritic targeting element and may play a role in mRNA trafficking. It is part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. KHSRP mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. It may interact with single-stranded DNA from the far-upstream element (FUSE).

Molekulargewicht: 73 kDa (MW of target protein)