RBMY1A1 Antikörper (N-Term)
-
- Target Alle RBMY1A1 Antikörper anzeigen
- RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBMY1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBMY1 A1 antibody was raised against the N terminal of RBMY1 1
- Aufreinigung
- Affinity purified
- Immunogen
- RBMY1 A1 antibody was raised using the N terminal of RBMY1 1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN
- Top Product
- Discover our top product RBMY1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBMY1A1 Blocking Peptide, catalog no. 33R-6530, is also available for use as a blocking control in assays to test for specificity of this RBMY1A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMY0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))
- Andere Bezeichnung
- RBMY1A1 (RBMY1A1 Produkte)
- Synonyme
- RBM antikoerper, Rbm1 antikoerper, Rbm1-rs1 antikoerper, Rbmy1a1 antikoerper, Rbmy1a1-rs1 antikoerper, Rbmy1b antikoerper, RBM1 antikoerper, RBM2 antikoerper, RBMY antikoerper, RBMY1C antikoerper, YRRM1 antikoerper, YRRM2 antikoerper, RNA binding motif protein, Y chromosome antikoerper, RNA binding motif protein, Y-linked, family 1, member A1 antikoerper, Rbmy antikoerper, RBMY1A1 antikoerper
- Hintergrund
- RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.
- Molekulargewicht
- 41 kDa (MW of target protein)
-